PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A08G1770
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family GATA
Protein Properties Length: 348aa    MW: 37901.9 Da    PI: 5.7661
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A08G1770genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA61.11.4e-19260293134
         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                  C++C +tkTp+WR+gp g+ktLCnaCG++yr+ +
  Gh_A08G1770 260 CTHCEVTKTPQWREGPKGPKTLCNACGVRYRSGR 293
                  *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004018.1E-18254304IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.108.1E-15258291IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.846258290IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.47E-14258317No hitNo description
CDDcd002023.42E-15259306No hitNo description
PfamPF003201.8E-17260293IPR000679Zinc finger, GATA-type
PROSITE patternPS003440260285IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MNNSWFNKCF DGFGVNDGLF DDLVKYLDFP LEDVEGTDDD GASGEGVVKD FHLPLDDVED  60
KSCVGGGGDD AGEDWDCNFQ NLEPPPANVL ASLSSGFCGD FFSDTLENKF PVSCDESSEL  120
NQLSGITKAS SSRSTTTLNG ESVGVKGSTW FQTSSPVSVL ETSSACSSAK PAPINPKLSF  180
LVKRDRSKRR RASTFNLQFT LPFISSTGST SLVGSESESE SHLTEKSAKK RQKKKNLTWL  240
SGSSENDRSS SEEAAVVRKC THCEVTKTPQ WREGPKGPKT LCNACGVRYR SGRLFPEYRP  300
AASPTFVASL HSNSHKKVIE MRKQCQAAEV GNTIYGVNST RNSNRIDY
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.49850.0boll| ovule
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00130DAPTransfer from AT1G08010Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012471520.11e-138PREDICTED: GATA transcription factor 11-like isoform X1
RefseqXP_012471521.11e-138PREDICTED: GATA transcription factor 11-like isoform X2
TrEMBLA0A0B0N6M60.0A0A0B0N6M6_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.29e-59GATA transcription factor 11